14-3-3 Theta Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A2563
Artikelname: 14-3-3 Theta Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A2563
Hersteller Artikelnummer: A2563
Alternativnummer: ABB-A2563-20UL,ABB-A2563-500UL,ABB-A2563-100UL,ABB-A2563-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: 1C5, HS1, 14-3-3, 14-3-3 Theta
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5 UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 10971
UniProt: P27348
Reinheit: Affinity purification
Sequenz: KNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAY
Target-Kategorie: YWHAQ
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Cell Cycle,Cell Cycle Control-G2 M DNA Damage Checkpoint,Neuroscience, Cell Type Marker,Stem Cells,Neuron marker,Synapse marker. Shipping: Ice Bag
Western blot analysis of various lysates using 14-3-3 Theta Rabbit pAb (A2563) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.