[KO Validated] MLH1 Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A25641
Artikelname: [KO Validated] MLH1 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A25641
Hersteller Artikelnummer: A25641
Alternativnummer: ABB-A25641-1000UL,ABB-A25641-100UL,ABB-A25641-20UL,ABB-A25641-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FCC2, COCA2, HNPCC, MLH-1, hMLH1, HNPCC2, LYNCH2, MMRCS1
The protein encoded by this gene can heterodimerize with mismatch repair endonuclease PMS2 to form MutL alpha, part of the DNA mismatch repair system. When MutL alpha is bound by MutS beta and some accessory proteins, the PMS2 subunit of MutL alpha introduces a single-strand break near DNA mismatches, providing an entry point for exonuclease degradation. The encoded protein is also involved in DNA damage signaling and can heterodimerize with DNA mismatch repair protein MLH3 to form MutL gamma, which is involved in meiosis. This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC).
Klonalität: Monoclonal
Molekulargewicht: 85 kDa
NCBI: 4292
UniProt: P40692
Reinheit: Affinity purification
Sequenz: PGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGD
Target-Kategorie: MLH1
Application Verdünnung: WB,1:8000 - 1:16000|IHC-P,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Cancer,Tumor suppressors. Shipping: Ice Bag
Western blot analysis of lysates from Mouse thymus using [KO Validated] MLH1 Rabbit mAb (A25641) at 1:8000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20 s.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using [KO Validated] MLH1 Rabbit mAb (A4858) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of lysates from wild type (WT) and MLH1 knockout (KO) HeLa cells using [KO Validated] MLH1 Rabbit mAb (A25641) at 1:8000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60 s.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] MLH1 Rabbit mAb (A25641) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human appendix tissue using [KO Validated] MLH1 Rabbit mAb (A25641) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using [KO Validated] MLH1 Rabbit mAb (A25641) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KO Validated] MLH1 Rabbit mAb (A25641) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human HeLa and HeLa-MLH1-KO cell line using [KO Validated] MLH1 Rabbit mAb (A25641) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.