CCL28 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A2596
Artikelname: CCL28 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A2596
Hersteller Artikelnummer: A2596
Alternativnummer: ABB-A2596-20UL,ABB-A2596-1000UL,ABB-A2596-100UL,ABB-A2596-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MEC, CCK1, SCYA28, CCL28
This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for resting CD4 or CD8 T cells and eosinophils. The product of this gene binds to chemokine receptors CCR3 and CCR10. This chemokine may play a role in the physiology of extracutaneous epithelial tissues, including diverse mucosal organs. Multiple transcript variants encoding two different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 56477
UniProt: Q9NRJ3
Reinheit: Affinity purification
Sequenz: SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Target-Kategorie: CCL28
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates, using CCL28 Rabbit pAb (A2596) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.