CD62P/P-selectin Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A27816
- Bilder (8)
| Artikelname: | CD62P/P-selectin Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A27816 |
| Hersteller Artikelnummer: | A27816 |
| Alternativnummer: | ABB-A27816-100UL,ABB-A27816-20UL,ABB-A27816-500UL,ABB-A27816-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD62, GRMP, PSEL, CD62P, GMP140, LECAM3, PADGEM |
| This gene encodes a 140 kDa protein that is stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. This protein redistributes to the plasma membrane during platelet activation and degranulation and mediates the interaction of activated endothelial cells or platelets with leukocytes. The membrane protein is a calcium-dependent receptor that binds to sialylated forms of Lewis blood group carbohydrate antigens on neutrophils and monocytes. Alternative splice variants may occur but are not well documented. |
| Klonalität: | Monoclonal |
| Molekulargewicht: | 91kDa |
| NCBI: | 6403 |
| UniProt: | P16109 |
| Reinheit: | Affinity purification |
| Sequenz: | WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGF |
| Target-Kategorie: | SELP |
| Application Verdünnung: | WB,1:2500 - 1:5000|IF-P,1:100 - 1:400|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology,Cell Adhesion,Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors,Cardiovascular,Blood. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from HEL cells using CD62P/P-selectin Rabbit mAb (A27816) at 1:5000 dilutionincubated overnight at 4°C. HEL cells were treated with PNGase F (1 µL) at 37°C for 30 minutes. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 30 µg per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using CD62P/P-selectin Rabbit mAb (A27816) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using CD62P/P-selectin Rabbit mAb (A27816) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using CD62P/P-selectin Rabbit mAb (A27816) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human lung tissue using CD62P/P-selectin Rabbit mAb (A27816) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using CD62P/P-selectin Rabbit mAb (A27816) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Confocal imaging of paraffin-embedded Human tonsil tissue using CD62P/P-selectin Rabbit mAb (A27816, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x. |
|
|
Confocal imaging of paraffin-embedded Human colon cancer tissue using CD62P/P-selectin Rabbit mAb (A27816, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x. |
Produktgarantie und fachkundiger Support
