HDAC6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A27908
Artikelname: HDAC6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A27908
Hersteller Artikelnummer: A27908
Alternativnummer: ABB-A27908-500UL,ABB-A27908-20UL,ABB-A27908-1000UL,ABB-A27908-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: Hd6, Sfc6, Hdac5, mHDA2
Enables several functions, including cytoskeletal protein binding activity, protein lysine deacetylase activity, and ubiquitin binding activity. Involved in several processes, including positive regulation of type 2 mitophagy, protein destabilization, and tubulin deacetylation. Acts upstream of or within several processes, including aggresome assembly, neuron projection morphogenesis, and protein modification process. Located in several cellular components, including dendrite, microtubule cytoskeleton, and perikaryon. Part of cytoplasmic ubiquitin ligase complex. Is expressed in several structures, including central nervous system, early embryo, gut gland, lung, and metanephros. Human ortholog(s) of this gene implicated in chondrodysplasia with platyspondyly, distinctive brachydactyly, hydrocephaly, and microphthalmia and polycystic liver disease 1. Orthologous to human HDAC6 (histone deacetylase 6).
Klonalität: Polyclonal
Molekulargewicht: 126kDa
NCBI: 15185
UniProt: Q9Z2V5
Reinheit: Affinity purification
Sequenz: MKMEDKEECSSSRLVIKKLPPTASPVSAKEMTTPKGKVPEESVRKTIAALPGKESTLGQAKSKMAKAVLAQGQSSEQAAKGTTLDLATSKETVGGATTDLWASAAAPENFPNQTTSVEALGETEPTPPASHTNKQTTGASPLQGVTAQQSLQLGVLSTLELSREAEEAHDSEEGLLGEAAGGQDMNSLMLTQGFGDFNTQDV
Target-Kategorie: HDAC6
Application Verdünnung: WB,1:3000 - 1:18000|IF/ICC,1:100 - 1:200|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics and Nuclear Signaling Chromatin Modifying Enzymes AcetylationStem Cells Signaling Pathways Wnt HDACsEpigenetics and Nuclear Signaling Chromatin Modifying Enzymes Acetylation HDACs Class II / Hda1 Class. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain using HDAC6 Rabbit pAb (A27908) at 1:3000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using HDAC6 Rabbit pAb (A27908) at a dilution of 1:700 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using HDAC6 Rabbit pAb (A27908) at a dilution of 1:700 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using HDAC6 Rabbit pAb (A27908) at a dilution of 1:700 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunofluorescence analysis of HCT 116 cells using HDAC6 Rabbit pAb (A27908) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of C2C12 cells using HDAC6 Rabbit pAb (A27908) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using HDAC6 Rabbit pAb (A27908) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using HDAC6 Rabbit pAb (A27908) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.