SIRT6 Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A28245
Artikelname: SIRT6 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A28245
Hersteller Artikelnummer: A28245
Alternativnummer: ABB-A28245-500UL,ABB-A28245-100UL,ABB-A28245-1000UL,ABB-A28245-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SIR2L6, hSIRT6
This gene encodes a member of the sirtuin family of NAD-dependent enzymes that are implicated in cellular stress resistance, genomic stability, aging and energy homeostasis. The encoded protein is localized to the nucleus, exhibits ADP-ribosyl transferase and histone deacetylase activities, and plays a role in DNA repair, maintenance of telomeric chromatin, inflammation, lipid and glucose metabolism. Alternative splicing results in multiple transcript variants encoding different isoforms.
Klonalität: Monoclonal
Molekulargewicht: 36 kDa/39 kDa
NCBI: 51548
UniProt: Q8N6T7
Reinheit: Affinity purification
Sequenz: MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIH
Target-Kategorie: SIRT6
Application Verdünnung: WB,1:3000 - 1:6000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|IF/ICC,1:100 - 1:200|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. For
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones. Shipping: Ice Bag
Western blot analysis of various lysates using SIRT6 Rabbit mAb (A28245) at 1:6000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90 s.
Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using SIRT6 Rabbit mAb (A28245) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using SIRT6 Rabbit mAb (A28245) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using SIRT6 Rabbit mAb (A28245) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using SIRT6 Rabbit mAb (A28245) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat skin tissue using SIRT6 Rabbit mAb (A28245) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Confocal imaging of Jurkat cells using SIRT6 Rabbit mAb (A28245, dilution 1:200) followed by a further incubation with Cy3-conjugated Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.
Immunoprecipitation of SIRT6 from 300 µg extracts of C2C12 cells was performed using 1 µg of SIRT6 Rabbit mAb (A28245). Rabbit Control IgG (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1x reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using SIRT6 Rabbit mAb (A28245) at a dilution of 1:5000.