SETD2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A3194
Artikelname: SETD2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A3194
Hersteller Artikelnummer: A3194
Alternativnummer: ABB-A3194-500UL,ABB-A3194-1000UL,ABB-A3194-100UL,ABB-A3194-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LLS, HYPB, SET2, HIF-1, HIP-1, KMT3A, MRD70, RAPAS, HBP231, HSPC069, p231HBP, SETD2
Huntingtons disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. This gene encodes a protein belonging to a class of huntingtin interacting proteins characterized by WW motifs. This protein is a histone methyltransferase that is specific for lysine-36 of histone H3, and methylation of this residue is associated with active chromatin. This protein also contains a novel transcriptional activation domain and has been found associated with hyperphosphorylated RNA polymerase II.
Klonalität: Polyclonal
Molekulargewicht: 288kDa
NCBI: 29072
UniProt: Q9BYW2
Reinheit: Affinity purification
Sequenz: RKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
Target-Kategorie: SETD2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using SETD2 Rabbit pAb (A3194) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using SETD2 Rabbit pAb (A3194) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of lysates from Mouse spleen, using SETD2 Rabbit pAb (A3194) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using SETD2 Rabbit pAb (A3194) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using SETD2 Rabbit pAb (A3194) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of C6 cells using SETD2 Rabbit pAb (A3194) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using SETD2 Rabbit pAb (A3194) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 600 µg extracts of Mouse spleen using 3 µg SETD2 antibody (A3194). Western blot was performed from the immunoprecipitate using SETD2 antibody (A3194) at a dilution of 1:1000.