Desmin Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A3736
Artikelname: Desmin Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A3736
Hersteller Artikelnummer: A3736
Alternativnummer: ABB-A3736-20UL,ABB-A3736-100UL,ABB-A3736-500UL,ABB-A3736-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CSM1, CSM2, CDCD3, LGMD1D, LGMD1E, LGMD2R, Desmin
This gene encodes a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0235]
Molekulargewicht: 54 kDa
NCBI: 1674
UniProt: P17661
Reinheit: Affinity purification
Sequenz: EEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
Target-Kategorie: DES
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|IF-P,1:100 - 1:1000|IHC-P,1:3000 - 1:12000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Extracellular Matrix,Stem Cells,Mesenchymal Stem Cells,Cardiovascular,Heart,Cardiac arrhythmias. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded mouse heart using Desmin Rabbit mAb (A3736) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Western blot analysis of various lysates using Desmin Rabbit mAb (A3736) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of paraffin-embedded rat heart using Desmin Rabbit mAb (A3736) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunohistochemistry analysis of paraffin-embeddedHuman thyroid tissue usingDesmin Rabbit mAb(A3736) at a dilution of 1:1600 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman lung tissue usingDesmin Rabbit mAb(A3736) at a dilution of 1:1600 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded mouse heart using Desmin Rabbit mAb (A3736) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded rat heart using Desmin Rabbit mAb (A3736) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.