UQCRC2 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A4366
- Bilder (9)
| Artikelname: | UQCRC2 Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A4366 |
| Hersteller Artikelnummer: | A4366 |
| Alternativnummer: | ABB-A4366-100UL,ABB-A4366-20UL,ABB-A4366-500UL,ABB-A4366-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | QCR2, UQCR2, MC3DN5, UQCRC2 |
| The protein encoded by this gene is located in the mitochondrion, where it is part of the ubiquinol-cytochrome c reductase complex (also known as complex III). This complex constitutes a part of the mitochondrial respiratory chain. Defects in this gene are a cause of mitochondrial complex III deficiency nuclear type 5. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC0982] |
| Molekulargewicht: | 48kDa |
| NCBI: | 7385 |
| UniProt: | P22695 |
| Reinheit: | Affinity purification |
| Sequenz: | KANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDV |
| Target-Kategorie: | UQCRC2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 14000|IHC-P,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Oxidative phosphorylation,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse heart, using UQCRC2 Rabbit mAb (A4366) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3min. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using UQCRC2 Rabbit mAb (A4366) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates using UQCRC2 Rabbit mAb (A4366) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using UQCRC2 Rabbit mAb (A4366) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human liver tissue using UQCRC2 Rabbit mAb (A4366) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using UQCRC2 Rabbit mAb (A4366) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using UQCRC2 Rabbit mAb (A4366) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat pancreas tissue using UQCRC2 Rabbit mAb (A4366) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using UQCRC2 Rabbit mAb (A4366) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining. |
Produktgarantie und fachkundiger Support
