PGRMC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A5619
Artikelname: PGRMC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A5619
Hersteller Artikelnummer: A5619
Alternativnummer: ABB-A5619-100UL,ABB-A5619-20UL,ABB-A5619-500UL,ABB-A5619-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: IZA, MPR, Dap1, HPR6.6, PGRMC1
This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney.
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 10857
UniProt: O00264
Reinheit: Affinity purification
Sequenz: KIVRGDQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND
Target-Kategorie: PGRMC1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Cardiovascular,Hypoxia. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Rat kidney using PGRMC1 Rabbit pAb (A5619) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil using PGRMC1 Rabbit pAb (A5619) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Western blot analysis of various lysates using PGRMC1 Rabbit pAb (A5619) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Human vermiform appendix using PGRMC1 Rabbit pAb (A5619) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse brain using PGRMC1 Rabbit pAb (A5619) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis of C6 cells using PGRMC1 Rabbit pAb (A5619) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using PGRMC1 Rabbit pAb (A5619) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using PGRMC1 Rabbit pAb (A5619) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.