WIPI1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7528
- Bilder (1)
| Artikelname: | WIPI1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7528 |
| Hersteller Artikelnummer: | A7528 |
| Alternativnummer: | ABB-A7528-100UL,ABB-A7528-20UL,ABB-A7528-1000UL,ABB-A7528-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ATG18, ATG18A, WIPI49, WIPI1 |
| This gene encodes a WD40 repeat protein. Members of the WD40 repeat family are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 49kDa |
| NCBI: | 55062 |
| UniProt: | Q5MNZ9 |
| Reinheit: | Affinity purification |
| Sequenz: | GTLAAITFNASGSKLASASEKGTVIRVFSVPDGQKLYEFRRGMKRYVTISSLVFSMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMGKMFMAATNYLPTQVSDMMHQDRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKG |
| Target-Kategorie: | WIPI1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using WIPI1 Rabbit pAb (A7528) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
