STK19 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7574
- Bilder (1)
| Artikelname: | STK19 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7574 |
| Hersteller Artikelnummer: | A7574 |
| Alternativnummer: | ABB-A7574-20UL,ABB-A7574-100UL,ABB-A7574-1000UL,ABB-A7574-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | G11, RP1, D6S60, D6S60E, HLA-RP1, STK19 |
| This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown, it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 41kDa |
| NCBI: | 8859 |
| UniProt: | P49842 |
| Reinheit: | Affinity purification |
| Sequenz: | GTPGETVRHCSAPEDPIFRFSSLHSYPFPGTIKSRDMSWKRHHLIPETFGVKRRRKRGPVESDPLRGEPGSARAAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTRVLKACDGRPYAGAVQKFLASVLPACGDLSFQQDQMTQTFGFRDSEITHLVNAGVLTVRDAGSWWLAVPGAGRFIKYFVKGRQAVLSMVRKAKYRELLLSELLGRRAPV |
| Target-Kategorie: | STK19 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using STK19 Rabbit pAb (A7574) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
