CD30 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7651
Artikelname: CD30 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7651
Hersteller Artikelnummer: A7651
Alternativnummer: ABB-A7651-100UL,ABB-A7651-20UL,ABB-A7651-1000UL,ABB-A7651-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CD30, Ki-1, D1S166E
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 943
UniProt: P28908
Reinheit: Affinity purification
Sequenz: LPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Target-Kategorie: TNFRSF8
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer,Tumor immunology,Tumor biomarkers,Signal Transduction,PI3K-Akt Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs,Cytokines,NF-kB Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using CD30 Rabbit pAb (A7651) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.