CEL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7652
- Bilder (1)
| Artikelname: | CEL Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7652 |
| Hersteller Artikelnummer: | A7652 |
| Alternativnummer: | ABB-A7652-100UL,ABB-A7652-20UL,ABB-A7652-500UL,ABB-A7652-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BAL, FAP, BSDL, BSSL, CELL, FAPP, LIPA, CEase, MODY8, CEL |
| The protein encoded by this gene is a glycoprotein secreted from the pancreas into the digestive tract and from the lactating mammary gland into human milk. The physiological role of this protein is in cholesterol and lipid-soluble vitamin ester hydrolysis and absorption. This encoded protein promotes large chylomicron production in the intestine. Also its presence in plasma suggests its interactions with cholesterol and oxidized lipoproteins to modulate the progression of atherosclerosis. In pancreatic tumoral cells, this encoded protein is thought to be sequestrated within the Golgi compartment and is probably not secreted. This gene contains a variable number of tandem repeat (VNTR) polymorphism in the coding region that may influence the function of the encoded protein. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 79kDa |
| NCBI: | 1056 |
| UniProt: | P19835 |
| Reinheit: | Affinity purification |
| Sequenz: | IDMPAINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYL |
| Target-Kategorie: | CEL |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Cell Biology Developmental Biology,Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CEL Rabbit pAb (A7652) at 1:500 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 30s. |
Produktgarantie und fachkundiger Support
