Ceruloplasmin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7658
- Bilder (1)
| Artikelname: | Ceruloplasmin Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7658 |
| Hersteller Artikelnummer: | A7658 |
| Alternativnummer: | ABB-A7658-100UL,ABB-A7658-20UL,ABB-A7658-1000UL,ABB-A7658-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CP-2, AB073614, Ceruloplasmin |
| The protein encoded by this gene is a metalloprotein that binds most of the copper in plasma and is involved in the peroxidation of Fe(II)transferrin to Fe(III) transferrin. Mutations in this gene cause aceruloplasminemia, which results in iron accumulation and tissue damage, and is associated with diabetes and neurologic abnormalities. Two transcript variants, one protein-coding and the other not protein-coding, have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 122kDa |
| NCBI: | 1356 |
| UniProt: | P00450 |
| Reinheit: | Affinity purification |
| Sequenz: | IRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSYKKLVYREYTDASFTNRKERGPEEEHLGILGPVIWAEVGDTIRVTFHNKGAYPLSIEPIGVRFNKNNEGTYYSPNYNPQSRSVPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKMYYSAVDPTKDIFTGLIGPMKICKKGSLHANGRQK |
| Target-Kategorie: | CP |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience,Neurodegenerative Diseases Markers,Other Neurological disorders,Cardiovascular,Blood,Serum Proteins. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Ceruloplasmin Rabbit pAb (A7658) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
