SLC4A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7729
Artikelname: SLC4A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7729
Hersteller Artikelnummer: A7729
Alternativnummer: ABB-A7729-20UL,ABB-A7729-100UL,ABB-A7729-500UL,ABB-A7729-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AE2, HKB3, BND3L, NBND3, EPB3L1, SLC4A2
This gene encodes a member of the anion exchanger family of membrane transport proteins. The encoded protein regulates intracellular pH, biliary bicarbonate secretion, and chloride uptake. Reduced expression of this gene may be associated with primary biliary cirrhosis (PBC) in human patients, while differential expression of this gene may be associated with malignant hepatocellular carcinoma, colon and gastric cancers.
Klonalität: Polyclonal
Molekulargewicht: 137kDa
NCBI: 6522
UniProt: P04920
Reinheit: Affinity purification
Sequenz: DDGGASGRPLPKAQPGHRSYNLQERRRIGSMTGAEQALLPRVPTDEIEAQTLATADLDLMKSHRFEDVPGVRRHLVRKNAKGSTQSGREGREPGPTPRARP
Target-Kategorie: SLC4A2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Endocrine Metabolism,Cardiovascular,Blood,Heart,Hypertrophy. Shipping: Ice Bag
Western blot analysis of various lysates using SLC4A2 Rabbit pAb (A7729) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.