NUP155 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7764
- Bilder (1)
| Artikelname: | NUP155 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7764 |
| Hersteller Artikelnummer: | A7764 |
| Alternativnummer: | ABB-A7764-100UL,ABB-A7764-20UL,ABB-A7764-500UL,ABB-A7764-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | N155, ATFB15, NUP155 |
| Nucleoporins are proteins that play an important role in the assembly and functioning of the nuclear pore complex (NPC) which regulates the movement of macromolecules across the nuclear envelope (NE). The protein encoded by this gene plays a role in the fusion of NE vesicles and formation of the double membrane NE. The protein may also be involved in cardiac physiology and may be associated with the pathogenesis of atrial fibrillation. Alternative splicing results in multiple transcript variants of this gene. A pseudogene associated with this gene is located on chromosome 6. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 155kDa |
| NCBI: | 9631 |
| UniProt: | O75694 |
| Reinheit: | Affinity purification |
| Sequenz: | ADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDA |
| Target-Kategorie: | NUP155 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using NUP155 Rabbit pAb (A7764) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 45s. |
Produktgarantie und fachkundiger Support
