PDE4DIP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7765
- Bilder (1)
| Artikelname: | PDE4DIP Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7765 |
| Hersteller Artikelnummer: | A7765 |
| Alternativnummer: | ABB-A7765-100UL,ABB-A7765-20UL,ABB-A7765-500UL,ABB-A7765-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MMGL, CMYA2, PDE4DIP |
| The protein encoded by this gene serves to anchor phosphodiesterase 4D to the Golgi/centrosome region of the cell. Defects in this gene may be a cause of myeloproliferative disorder (MBD) associated with eosinophilia. Several transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 265kDa |
| NCBI: | 9659 |
| UniProt: | Q5VU43 |
| Reinheit: | Affinity purification |
| Sequenz: | MKGTDSGSCCRRRCDFGCCCRASRRAHYTPYRSGDATRTPQSPRQTPSRERRRPEPAGSWAAAAEEEEAAAAATPWMRDYFAEDDGEMVPRTSHTAAFLSDTKDRGPPVQSQIWRSGEKVPFVQTYSLRAFEKPPQVQTQALRDFEKHLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKRELQDKKQHLDKTWADVENLNSQNEAELRRQFEERQQETEHVYELLENKIQLLQEESRL |
| Target-Kategorie: | PDE4DIP |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cytoskeleton,Microfilaments,Actins,Cardiovascular,Heart,Contractility. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from mouse skeletal muscle, using PDE4DIP Rabbit pAb (A7765) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
