PDE4DIP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7765
Artikelname: PDE4DIP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7765
Hersteller Artikelnummer: A7765
Alternativnummer: ABB-A7765-100UL,ABB-A7765-20UL,ABB-A7765-500UL,ABB-A7765-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MMGL, CMYA2, PDE4DIP
The protein encoded by this gene serves to anchor phosphodiesterase 4D to the Golgi/centrosome region of the cell. Defects in this gene may be a cause of myeloproliferative disorder (MBD) associated with eosinophilia. Several transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 265kDa
NCBI: 9659
UniProt: Q5VU43
Reinheit: Affinity purification
Sequenz: MKGTDSGSCCRRRCDFGCCCRASRRAHYTPYRSGDATRTPQSPRQTPSRERRRPEPAGSWAAAAEEEEAAAAATPWMRDYFAEDDGEMVPRTSHTAAFLSDTKDRGPPVQSQIWRSGEKVPFVQTYSLRAFEKPPQVQTQALRDFEKHLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKRELQDKKQHLDKTWADVENLNSQNEAELRRQFEERQQETEHVYELLENKIQLLQEESRL
Target-Kategorie: PDE4DIP
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cytoskeleton,Microfilaments,Actins,Cardiovascular,Heart,Contractility. Shipping: Ice Bag
Western blot analysis of lysates from mouse skeletal muscle, using PDE4DIP Rabbit pAb (A7765) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.