AKR1B10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7823
- Bilder (1)
| Artikelname: | AKR1B10 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7823 |
| Hersteller Artikelnummer: | A7823 |
| Alternativnummer: | ABB-A7823-100UL,ABB-A7823-20UL,ABB-A7823-500UL,ABB-A7823-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IP, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HIS, HSI, ARL1, ARL-1, ALDRLn, AKR1B11, AKR1B12, AKR1B10 |
| This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 36kDa |
| NCBI: | 57016 |
| UniProt: | O60218 |
| Reinheit: | Affinity purification |
| Sequenz: | MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTAAQVLIRFHIQ |
| Target-Kategorie: | AKR1B10 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Signal Transduction,Endocrine Metabolism,Drug metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using AKR1B10 Rabbit pAb (A7823) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
