REEP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7832
Artikelname: REEP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7832
Hersteller Artikelnummer: A7832
Alternativnummer: ABB-A7832-20UL,ABB-A7832-100UL,ABB-A7832-500UL,ABB-A7832-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DSMA6, HMN5B, SPG31, Yip2a, C2orf23, REEP1
This gene encodes a mitochondrial protein that functions to enhance the cell surface expression of odorant receptors. Mutations in this gene cause spastic paraplegia autosomal dominant type 31, a neurodegenerative disorder. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 65055
UniProt: Q9H902
Reinheit: Affinity purification
Sequenz: KEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTA
Target-Kategorie: REEP1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag
Western blot analysis of various lysates using REEP1 Rabbit pAb (A7832) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.