TGS1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7848
Artikelname: TGS1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7848
Hersteller Artikelnummer: A7848
Alternativnummer: ABB-A7848-20UL,ABB-A7848-100UL,ABB-A7848-1000UL,ABB-A7848-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PIMT, PIPMT, NCOA6IP, TGS1
Enables RNA trimethylguanosine synthase activity. Involved in 7-methylguanosine cap hypermethylation. Located in cytosol and nucleus.
Klonalität: Polyclonal
Molekulargewicht: 97kDa
NCBI: 96764
UniProt: Q96RS0
Reinheit: Affinity purification
Sequenz: RVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGDLIRRPASET
Target-Kategorie: TGS1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Nuclear hormone receptors,Cancer. Shipping: Ice Bag
Western blot analysis of various lysates using TGS1 Rabbit pAb (A7848) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.