PHF21B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7849
- Bilder (1)
| Artikelname: | PHF21B Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7849 |
| Hersteller Artikelnummer: | A7849 |
| Alternativnummer: | ABB-A7849-20UL,ABB-A7849-100UL,ABB-A7849-500UL,ABB-A7849-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PHF4, BHC80L, PHF21B |
| Predicted to enable metal ion binding activity. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 57kDa |
| NCBI: | 112885 |
| UniProt: | Q96EK2 |
| Reinheit: | Affinity purification |
| Sequenz: | KRLASNYLNNPLFLTARANEDPCWKNEITHDEHCAACKRGANLQPCGTCPGAYHLSCLEPPLKTAPKGVWVCPRCQQKALKKDEGVPWTGMLAIVHSYVTHKTVKEEEKQKLLQRGSELQNEHQQLEERDRRLASAVQKCLELKTSLLARQRGTQSSLDRLRALLRLIQGEQLLQVTMTTTSPAPLLAGPWTKPSVAATHPTVQHPQGHN |
| Target-Kategorie: | PHF21B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag |

