Clathrin heavy chain Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7886
Artikelname: Clathrin heavy chain Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7886
Hersteller Artikelnummer: A7886
Alternativnummer: ABB-A7886-100UL,ABB-A7886-20UL,ABB-A7886-1000UL,ABB-A7886-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: Hc, CHC, CHC17, MRD56, CLH-17, CLTCL2, Clathrin heavy chain
Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains.
Klonalität: Polyclonal
Molekulargewicht: 192kDa
NCBI: 1213
UniProt: Q00610
Reinheit: Affinity purification
Sequenz: AEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVP
Target-Kategorie: CLTC
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Immunology Inflammation,B Cell Receptor Signaling Pathway,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag
Western blot analysis of various lysates using Clathrin heavy chain Rabbit pAb (A7886) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.