LIM2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7909
Artikelname: LIM2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7909
Hersteller Artikelnummer: A7909
Alternativnummer: ABB-A7909-20UL,ABB-A7909-100UL,ABB-A7909-500UL,ABB-A7909-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MP17, MP19, CTRCT19, LIM2
This gene encodes an eye lens-specific protein found at the junctions of lens fiber cells, where it may contribute to cell junctional organization. It acts as a receptor for calmodulin, and may play an important role in both lens development and cataractogenesis. Mutations in this gene have been associated with cataract formation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 3982
UniProt: P55344
Reinheit: Affinity purification
Sequenz: TDHWMQYRLSGSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLYSRWRTLRLKEGKGATQAYWNATRAFM
Target-Kategorie: LIM2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using LIM2 Rabbit pAb (A7909) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.