PSPH Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7924
- Bilder (1)
| Artikelname: | PSPH Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7924 |
| Hersteller Artikelnummer: | A7924 |
| Alternativnummer: | ABB-A7924-20UL,ABB-A7924-100UL,ABB-A7924-500UL,ABB-A7924-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PSP, PSPHD, PSPH |
| The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine. Deficiency of this protein is thought to be linked to Williams syndrome. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 25kDa |
| NCBI: | 5723 |
| UniProt: | P78330 |
| Reinheit: | Affinity purification |
| Sequenz: | MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE |
| Target-Kategorie: | PSPH |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag |

