WNT9A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A7939
Artikelname: WNT9A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A7939
Hersteller Artikelnummer: A7939
Alternativnummer: ABB-A7939-20UL,ABB-A7939-100UL,ABB-A7939-1000UL,ABB-A7939-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: WNT14, WNT9A
The WNT gene family consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is expressed in gastric cancer cell lines. The protein encoded by this gene shows 75% amino acid identity to chicken Wnt14, which has been shown to play a central role in initiating synovial joint formation in the chick limb. This gene is clustered with another family member, WNT3A, in the chromosome 1q42 region.
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 7483
UniProt: O14904
Reinheit: Affinity purification
Sequenz: ALKVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFCLAGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVE
Target-Kategorie: WNT9A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Cancer,Tumor suppressors,Signal Transduction,mTOR Signaling Pathway,Cell Biology Developmental Biology,Wnt -Catenin Signaling Pathway,ESC Pluripotency and Differentiation,Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from mouse lung, using WNT9A Rabbit pAb (A7939) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.