ERp29 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7959
- Bilder (1)
| Artikelname: | ERp29 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7959 |
| Hersteller Artikelnummer: | A7959 |
| Alternativnummer: | ABB-A7959-20UL,ABB-A7959-500UL,ABB-A7959-1000UL,ABB-A7959-100UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ERp28, ERp31, PDIA9, PDI-DB, C12orf8, HEL-S-107, ERp29 |
| This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 29kDa |
| NCBI: | 10961 |
| UniProt: | P30040 |
| Reinheit: | Affinity purification |
| Sequenz: | LHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL |
| Target-Kategorie: | ERP29 |
| Application Verdünnung: | WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ERp29 Rabbit pAb (A7959) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 µg per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:1s. |
Produktgarantie und fachkundiger Support
