ACSL6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7965
- Bilder (1)
| Artikelname: | ACSL6 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7965 |
| Hersteller Artikelnummer: | A7965 |
| Alternativnummer: | ABB-A7965-100UL,ABB-A7965-20UL,ABB-A7965-1000UL,ABB-A7965-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ACS2, FACL6, LACS2, LACS5, LACS 6, ACSL6 |
| The protein encoded by this gene catalyzes the formation of acyl-CoA from fatty acids, ATP, and CoA, using magnesium as a cofactor. The encoded protein plays a major role in fatty acid metabolism in the brain. Translocations with the ETV6 gene are causes of myelodysplastic syndrome with basophilia, acute myelogenous leukemia with eosinophilia, and acute eosinophilic leukemia. Several transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 78kDa |
| NCBI: | 23305 |
| UniProt: | Q9UKU0 |
| Reinheit: | Affinity purification |
| Sequenz: | YGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIKLVDVEELNYWACKGEGEICVRGPNVFKGYLKDPDRTKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLCTNKDLKKAILEDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSISM |
| Target-Kategorie: | ACSL6 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat brain, using ACSL6 Rabbit pAb (A7965) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
