FTSJ1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7967
- Bilder (1)
| Artikelname: | FTSJ1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7967 |
| Hersteller Artikelnummer: | A7967 |
| Alternativnummer: | ABB-A7967-100UL,ABB-A7967-20UL,ABB-A7967-1000UL,ABB-A7967-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | JM23, MRX9, SPB1, CDLIV, MRX44, TRMT7, XLID9, FTSJ1 |
| This gene encodes a member of the methyltransferase superfamily. The encoded protein localizes to the nucleolus, binds to S-adenosylmethionine, and may be involved in the processing and modification of ribosomal RNA. Mutations in this gene are associated with cognitive disability. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 36kDa |
| NCBI: | 24140 |
| UniProt: | Q9UET6 |
| Reinheit: | Affinity purification |
| Sequenz: | LQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP |
| Target-Kategorie: | FTSJ1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |

