IL20RB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A7980
- Bilder (1)
| Artikelname: | IL20RB Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A7980 |
| Hersteller Artikelnummer: | A7980 |
| Alternativnummer: | ABB-A7980-20UL,ABB-A7980-100UL,ABB-A7980-1000UL,ABB-A7980-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DIRS1, FNDC6, IL-20R2, IL20RB |
| IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20, MIM 605619) (Blumberg et al., 2001 [PubMed 11163236]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 35kDa |
| NCBI: | 53833 |
| UniProt: | Q6UXL0 |
| Reinheit: | Affinity purification |
| Sequenz: | MKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAE |
| Target-Kategorie: | IL20RB |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor immunology,Immunology Inflammation,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using IL20RB Rabbit pAb (A7980) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
