EFHC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8002
Artikelname: EFHC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8002
Hersteller Artikelnummer: A8002
Alternativnummer: ABB-A8002-100UL,ABB-A8002-20UL,ABB-A8002-1000UL,ABB-A8002-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: EJM1, POC9, RIB72, dJ304B14.2, EFHC1
This gene encodes an EF-hand-containing calcium binding protein. The encoded protein likely plays a role in calcium homeostasis. Mutations in this gene have been associated with susceptibility to juvenile myoclonic epilepsy and juvenile absence epilepsy. Alternatively spliced transcript variants have been described.
Klonalität: Polyclonal
Molekulargewicht: 74kDa
NCBI: 114327
UniProt: Q5JVL4
Reinheit: Affinity purification
Sequenz: EDSAQNCFALIPKAPKKDVIKMLVNDNKVLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELIRMCSHGEGKINYYNFVRAFSN
Target-Kategorie: EFHC1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using EFHC1 Rabbit pAb (A8002) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.