CNOT8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8058
- Bilder (1)
| Artikelname: | CNOT8 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8058 |
| Hersteller Artikelnummer: | A8058 |
| Alternativnummer: | ABB-A8058-100UL,ABB-A8058-20UL,ABB-A8058-500UL,ABB-A8058-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CAF1, POP2, CALIF, Caf1b, hCAF1, CNOT8 |
| Enables poly(A)-specific ribonuclease activity. Involved in exonucleolytic catabolism of deadenylated mRNA and positive regulation of cell population proliferation. Located in nucleus. Part of CCR4-NOT complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 34kDa |
| NCBI: | 9337 |
| UniProt: | Q9UFF9 |
| Reinheit: | Affinity purification |
| Sequenz: | MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKY |
| Target-Kategorie: | CNOT8 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CNOT8 Rabbit pAb (A8058) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
