ARNT2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8060
- Bilder (1)
| Artikelname: | ARNT2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8060 |
| Hersteller Artikelnummer: | A8060 |
| Alternativnummer: | ABB-A8060-100UL,ABB-A8060-20UL,ABB-A8060-500UL,ABB-A8060-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | WEDAS, bHLHe1, ARNT2 |
| This gene encodes a member of the basic-helix-loop-helix-Per-Arnt-Sim (bHLH-PAS) superfamily of transcription factors. The encoded protein acts as a partner for several sensor proteins of the bHLH-PAS family, forming heterodimers with the sensor proteins that bind regulatory DNA sequences in genes responsive to developmental and environmental stimuli. Under hypoxic conditions, the encoded protein complexes with hypoxia-inducible factor 1alpha in the nucleus and this complex binds to hypoxia-responsive elements in enhancers and promoters of oxygen-responsive genes. A highly similar protein in mouse forms functional complexes with both aryl hydrocarbon receptors and Single-minded proteins, suggesting additional roles for the encoded protein in the metabolism of xenobiotic compounds and the regulation of neurogenesis, respectively. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 79kDa |
| NCBI: | 9915 |
| UniProt: | Q9HBZ2 |
| Reinheit: | Affinity purification |
| Sequenz: | QLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGEQHSHQQPGQTEVFQDMLPM |
| Target-Kategorie: | ARNT2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ARNT2 Rabbit pAb (A8060) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s. |
Produktgarantie und fachkundiger Support
