ADAMTSL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8073
- Bilder (1)
| Artikelname: | ADAMTSL1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8073 |
| Hersteller Artikelnummer: | A8073 |
| Alternativnummer: | ABB-A8073-100UL,ABB-A8073-20UL,ABB-A8073-500UL,ABB-A8073-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C9orf94, PUNCTIN, ADAMTSR1, ADAMTSL-1, ADAMTSL1 |
| This gene encodes a secreted protein and member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) family. This protein lacks the metalloproteinase and disintegrin-like domains, which are typical of the ADAMTS family, but contains other ADAMTS domains, including the thrombospondin type 1 motif. This protein may have important functions in the extracellular matrix. Alternative splicing results in multiple transcript variants encoding distinct proteins. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 62kDa |
| NCBI: | 92949 |
| UniProt: | Q8N6G6 |
| Reinheit: | Affinity purification |
| Sequenz: | SLVIQDYWWSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQQLCVEWAFSSWGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHARTNKAVPEHLCSWGPRPANWQRCNITPCENMECRDTTRYC |
| Target-Kategorie: | ADAMTSL1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ADAMTSL1 Rabbit pAb (A8073) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s. |
Produktgarantie und fachkundiger Support
