NPY4R Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8143
Artikelname: NPY4R Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8143
Hersteller Artikelnummer: A8143
Alternativnummer: ABB-A8143-20UL,ABB-A8143-100UL,ABB-A8143-500UL,ABB-A8143-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: Y4, PP1, PPYR1, NPY4-R, NPY4R
Enables pancreatic polypeptide receptor activity and peptide hormone binding activity. Involved in G protein-coupled receptor signaling pathway. Located in membrane.
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 5540
UniProt: P50391
Reinheit: Affinity purification
Sequenz: MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQKEKANVTNLLI
Target-Kategorie: NPY4R
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR. Shipping: Ice Bag
Western blot analysis of various lysates using NPY4R Rabbit pAb (A8143) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.