SRM Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8151
- Bilder (1)
| Artikelname: | SRM Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8151 |
| Hersteller Artikelnummer: | A8151 |
| Alternativnummer: | ABB-A8151-20UL,ABB-A8151-100UL,ABB-A8151-1000UL,ABB-A8151-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PAPT, SPS1, SPDSY, SRML1, SRM |
| The polyamines putrescine, spermine, and spermidine are ubiquitous polycationic mediators of cell growth and differentiation. Spermidine synthase is one of four enzymes in the polyamine-biosynthetic pathway and carries out the final step of spermidine biosynthesis. This enzyme catalyzes the conversion of putrescine to spermidine using decarboxylated S-adenosylmethionine as the cofactor. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 34kDa |
| NCBI: | 6723 |
| UniProt: | P19623 |
| Reinheit: | Affinity purification |
| Sequenz: | MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNP |
| Target-Kategorie: | SRM |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag |

