STXBP3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8153
- Bilder (1)
| Artikelname: | STXBP3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8153 |
| Hersteller Artikelnummer: | A8153 |
| Alternativnummer: | ABB-A8153-100UL,ABB-A8153-20UL,ABB-A8153-500UL,ABB-A8153-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PSP, MUNC18C, UNC-18C, MUNC18-3, STXBP3 |
| Enables syntaxin binding activity. Involved in negative regulation of calcium ion-dependent exocytosis, neutrophil degranulation, and platelet aggregation. Located in cytosol, plasma membrane, and secretory granule. Is active in presynapse. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 68kDa |
| NCBI: | 6814 |
| UniProt: | O00186 |
| Reinheit: | Affinity purification |
| Sequenz: | KQVVHLNLAEDCMNKFKLNIEKLCKTEQDLALGTDAEGQKVKDSMRVLLPVLLNKNHDNCDKIRAILLYIFSINGTTEENLDRLIQNVKIENESDMIRNWSYLGVPIVPQSQQGKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYCSQCPAVWNGSGAVSARQKPRANYLEDRKNGSKLIVFVIGGITYSEVRCAYEVSQAHKSCEVIIGSTHVLTPKKLLDDIKMLNKPKDKVSLIKDE |
| Target-Kategorie: | STXBP3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using STXBP3 Rabbit pAb (A8153) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
