GPRC5A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8173
Artikelname: GPRC5A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8173
Hersteller Artikelnummer: A8173
Alternativnummer: ABB-A8173-20UL,ABB-A8173-100UL,ABB-A8173-500UL,ABB-A8173-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RAI3, TIG1, RAIG1, GPCR5A, PEIG-1, GPRC5A
This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation.
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 9052
UniProt: Q8NFJ5
Reinheit: Affinity purification
Sequenz: LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
Target-Kategorie: GPRC5A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from MKN-45 cells, using GPRC5A Rabbit pAb (A8173) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.