SLC9A6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8187
- Bilder (1)
| Artikelname: | SLC9A6 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8187 |
| Hersteller Artikelnummer: | A8187 |
| Alternativnummer: | ABB-A8187-100UL,ABB-A8187-20UL,ABB-A8187-1000UL,ABB-A8187-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MRSA, NHE6, MRXSCH, SLC9A6 |
| This gene encodes a sodium-hydrogen exchanger that is amember of the solute carrier family 9. The encoded protein localizes to early and recycling endosomes and may be involved in regulating endosomal pH and volume. Defects in this gene are associated with X-linked syndromic cognitive disability, Christianson type. Alternate splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 78kDa |
| NCBI: | 10479 |
| UniProt: | Q92581 |
| Reinheit: | Affinity purification |
| Sequenz: | VDSDQEHLGVPENERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILNDGDISLTYGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA |
| Target-Kategorie: | SLC9A6 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SLC9A6 Rabbit pAb (A8187) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
