NDUFA12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8237
- Bilder (1)
| Artikelname: | NDUFA12 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8237 |
| Hersteller Artikelnummer: | A8237 |
| Alternativnummer: | ABB-A8237-20UL,ABB-A8237-100UL,ABB-A8237-1000UL,ABB-A8237-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | B17.2, DAP13, MC1DN23, NDUFA12 |
| This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 17kDa |
| NCBI: | 55967 |
| UniProt: | Q9UI09 |
| Reinheit: | Affinity purification |
| Sequenz: | MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK |
| Target-Kategorie: | NDUFA12 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using NDUFA12 Rabbit pAb (A8237) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
