CHMP1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8239
- Bilder (1)
| Artikelname: | CHMP1B Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8239 |
| Hersteller Artikelnummer: | A8239 |
| Alternativnummer: | ABB-A8239-20UL,ABB-A8239-100UL,ABB-A8239-500UL,ABB-A8239-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Vps46B, C10orf2, C18orf2, CHMP1.5, Vps46-2, C18-ORF2, hVps46-2, CHMP1B |
| CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 22kDa |
| NCBI: | 57132 |
| UniProt: | Q7LBR1 |
| Reinheit: | Affinity purification |
| Sequenz: | MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV |
| Target-Kategorie: | CHMP1B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CHMP1B Rabbit pAb (A8239) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
