ADAM33 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8265
- Bilder (1)
| Artikelname: | ADAM33 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8265 |
| Hersteller Artikelnummer: | A8265 |
| Alternativnummer: | ABB-A8265-20UL,ABB-A8265-100UL,ABB-A8265-500UL,ABB-A8265-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C20orf153, DJ964F7.1, ADAM33 |
| This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 88kDa |
| NCBI: | 80332 |
| UniProt: | Q9BZ11 |
| Reinheit: | Affinity purification |
| Sequenz: | YLLDGSPCARGSGYCWDGACPTLEQQCQQLWGPGSHPAPEACFQVVNSAGDAHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLDLLGLGLVEPGTQCGPRMVCQSRRCRKNAFQELQRCLTACHSHGVCNSNHNCHCAPGWAPPFCDKPGFGGSMDSGPVQAENHD |
| Target-Kategorie: | ADAM33 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Ubiquitin. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ADAM33 Rabbit pAb (A8265) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s. |
Produktgarantie und fachkundiger Support
