DCP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8282
- Bilder (1)
| Artikelname: | DCP2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8282 |
| Hersteller Artikelnummer: | A8282 |
| Alternativnummer: | ABB-A8282-100UL,ABB-A8282-20UL,ABB-A8282-500UL,ABB-A8282-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NUDT20, DCP2 |
| The protein encoded by this gene is a key component of an mRNA-decapping complex required for degradation of mRNAs, both in normal mRNA turnover, and in nonsense-mediated mRNA decay (NMD). It removes the 7-methyl guanine cap structure from mRNA, prior to its degradation from the 5 end. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 48kDa |
| NCBI: | 167227 |
| UniProt: | Q8IU60 |
| Reinheit: | Affinity purification |
| Sequenz: | METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLS |
| Target-Kategorie: | DCP2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using DCP2 Rabbit pAb (A8282) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
