IL36G Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8304
- Bilder (1)
| Artikelname: | IL36G Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8304 |
| Hersteller Artikelnummer: | A8304 |
| Alternativnummer: | ABB-A8304-100UL,ABB-A8304-20UL,ABB-A8304-500UL,ABB-A8304-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IL1E, IL1F9, IL1H1, IL-1F9, IL-1H1, IL1RP2, IL-1RP2, IL36G |
| The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 19kDa |
| NCBI: | 56300 |
| UniProt: | Q9NZH8 |
| Reinheit: | Affinity purification |
| Sequenz: | MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND |
| Target-Kategorie: | IL36G |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Growth factors,Immunology Inflammation,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from 293F-IL36G-N cells, using IL36G Rabbit pAb (A8304) at 1:800 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
