SIK2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8321
Artikelname: SIK2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8321
Hersteller Artikelnummer: A8321
Alternativnummer: ABB-A8321-20UL,ABB-A8321-100UL,ABB-A8321-500UL,ABB-A8321-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: QIK, SIK-2, SNF1LK2, LOH11CR1I, SIK2
Enables ATP binding activity, magnesium ion binding activity, and protein serine/threonine kinase activity. Involved in intracellular signal transduction and protein autophosphorylation. Predicted to be located in nucleus. Predicted to be active in cytoplasm.
Klonalität: Polyclonal
Molekulargewicht: 104kDa
NCBI: 23235
UniProt: Q9H0K1
Reinheit: Affinity purification
Sequenz: PPPPPPRQPGAAPAPLQFSYQTCELPSAASPAPDYPTPCQYPVDGAQQSDLTGPDCPRSPGLQEAPSSYDPLALSELPGLFDCEMLDAVDPQHNGYVLVN
Target-Kategorie: SIK2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Growth factors,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Cardiovascular. Shipping: Ice Bag
Western blot analysis of various lysates using SIK2 Rabbit pAb (A8321) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.