ANAPC10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8330
- Bilder (1)
| Artikelname: | ANAPC10 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8330 |
| Hersteller Artikelnummer: | A8330 |
| Alternativnummer: | ABB-A8330-100UL,ABB-A8330-20UL,ABB-A8330-500UL,ABB-A8330-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DOC1, APC10, ANAPC10 |
| ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1, MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1, MIM 123836), the activating subunit of cyclin-dependent kinase-1 (CDK1, MIM 116940) (summary by Wendt et al., 2001 [PubMed 11524682]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 21kDa |
| NCBI: | 10393 |
| UniProt: | Q9UM13 |
| Reinheit: | Affinity purification |
| Sequenz: | MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR |
| Target-Kategorie: | ANAPC10 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ANAPC10 Rabbit pAb (A8330) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
