GTF3A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8426
Artikelname: GTF3A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8426
Hersteller Artikelnummer: A8426
Alternativnummer: ABB-A8426-20UL,ABB-A8426-100UL,ABB-A8426-1000UL,ABB-A8426-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AP2, TFIIIA, GTF3A
The product of this gene is a zinc finger protein with nine Cis[2]-His[2] zinc finger domains. It functions as an RNA polymerase III transcription factor to induce transcription of the 5S rRNA genes. The protein binds to a 50 bp internal promoter in the 5S genes called the internal control region (ICR), and nucleates formation of a stable preinitiation complex. This complex recruits the TFIIIC and TFIIIB transcription factors and RNA polymerase III to form the complete transcription complex. The protein is thought to be translated using a non-AUG translation initiation site in mammals based on sequence analysis, protein homology, and the size of the purified protein.
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 2971
UniProt: Q92664
Reinheit: Affinity purification
Sequenz: MDPPAVVAESVSSLTIADAFIAAGESSAPTPPRPALPRRFICSFPDCSANYSKAWKLDAHLCKHTGERPFVCDYEGCGKAFIRDYHLSRHILTHTGEKPF
Target-Kategorie: GTF3A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from 293F cells, using GTF3A Rabbit pAb (A8426) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.