MYL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8438
Artikelname: MYL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8438
Hersteller Artikelnummer: A8438
Alternativnummer: ABB-A8438-100UL,ABB-A8438-20UL,ABB-A8438-1000UL,ABB-A8438-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MLC1, MLC-1, MLC1F, MLC3F, CMYP14, MLC1/3, MYOFTA, MYL1
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene.
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 4632
UniProt: P05976
Reinheit: Affinity purification
Sequenz: MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI
Target-Kategorie: MYL1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cytoskeleton,Actins,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using MYL1 Rabbit pAb (A8438) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.