MYL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A8438
- Bilder (1)
| Artikelname: | MYL1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A8438 |
| Hersteller Artikelnummer: | A8438 |
| Alternativnummer: | ABB-A8438-100UL,ABB-A8438-20UL,ABB-A8438-1000UL,ABB-A8438-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MLC1, MLC-1, MLC1F, MLC3F, CMYP14, MLC1/3, MYOFTA, MYL1 |
| Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 21kDa |
| NCBI: | 4632 |
| UniProt: | P05976 |
| Reinheit: | Affinity purification |
| Sequenz: | MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI |
| Target-Kategorie: | MYL1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cytoskeleton,Actins,Stem Cells. Shipping: Ice Bag |

