OPRD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8445
Artikelname: OPRD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8445
Hersteller Artikelnummer: A8445
Alternativnummer: ABB-A8445-100UL,ABB-A8445-20UL,ABB-A8445-500UL,ABB-A8445-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DOP, DOR, DOR1, OPRD, OPRD1
Enables G protein-coupled enkephalin receptor activity. Involved in several processes, including G protein-coupled opioid receptor signaling pathway, cellular response to hypoxia, and positive regulation of peptidyl-serine phosphorylation. Is intrinsic component of plasma membrane.
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 4985
UniProt: P41143
Reinheit: Affinity purification
Sequenz: LHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA
Target-Kategorie: OPRD1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using OPRD1 Rabbit pAb (A8445) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.