PDE3B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A8448
Artikelname: PDE3B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A8448
Hersteller Artikelnummer: A8448
Alternativnummer: ABB-A8448-20UL,ABB-A8448-100UL,ABB-A8448-500UL,ABB-A8448-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HcGIP1, cGIPDE1, PDE3B
Enables 3,5-cyclic-nucleotide phosphodiesterase activity. Involved in negative regulation of angiogenesis, negative regulation of cell adhesion, and negative regulation of lipid catabolic process. Located in membrane. Part of guanyl-nucleotide exchange factor complex.
Klonalität: Polyclonal
Molekulargewicht: 124kDa
NCBI: 5140
UniProt: Q13370
Reinheit: Affinity purification
Sequenz: PLTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIE
Target-Kategorie: PDE3B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Insulin Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using PDE3B Rabbit pAb (A8448) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 40s.